PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00207.1_g00028.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 568aa    MW: 62959.4 Da    PI: 6.7706
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00207.1_g00028.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.32.1e-142976148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+ Ede+l+ +v++ G g+W++  ++  + R++k+c++rw ++l
  Rsa1.0_00207.1_g00028.1 29 KGPWTAAEDEILAAYVRENGEGNWNALQKHTCLARCGKSCRLRWANHL 76
                             79******************************************9986 PP

2Myb_DNA-binding49.51e-1582125146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              +g++T +E+ l++++++qlG++ W++ a+ ++ gRt++++k++w++
  Rsa1.0_00207.1_g00028.1  82 KGSFTDDEERLIIQLHAQLGNK-WARMAAQLP-GRTDNEIKNYWNT 125
                              799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.7742476IPR017930Myb domain
SuperFamilySSF466891.05E-2727123IPR009057Homeodomain-like
SMARTSM007171.1E-112878IPR001005SANT/Myb domain
PfamPF002495.1E-132976IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-223083IPR009057Homeodomain-like
CDDcd001671.67E-93176No hitNo description
PROSITE profilePS5129425.60577131IPR017930Myb domain
SMARTSM007176.3E-1681129IPR001005SANT/Myb domain
PfamPF002492.3E-1482125IPR001005SANT/Myb domain
CDDcd001672.76E-1184127No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2484129IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
MILYGVGTGN DGGSTNHISD GGGRVALKKG PWTAAEDEIL AAYVRENGEG NWNALQKHTC  60
LARCGKSCRL RWANHLRPNL KKGSFTDDEE RLIIQLHAQL GNKWARMAAQ LPGRTDNEIK  120
NYWNTRLKRL QRQGLPLYPP DVIPNHQLHP HPQHHHQQQH QHQQMYFHPH SSQPNTPSSS  180
PLPSPTPANA NPSSSFTFHT TNASTANFIH PLSPHTPTTP QTPSQLSSRP PPQPLSSPLS  240
SPLNSQYPTL PLFNNNNNNT NFTFPRPTPL LQPPSSFLAR RYNSNTSLNY TNRVSTAPFS  300
PVSRDSYTSF LTLPYSSSAA PNATYHNTNN NYSSFSLNPS SSSYPTTTSS PSFLHSHYTP  360
NSSSTSFHTN PVYSMKQELP SSQTPQICDF SNVNNFTYNE KQNSTGLHRR STSCSLLEDV  420
MEEAEALDGG GGGGCRPPKR RQLTSSPLNN HHNDNNNDNN NNDNDFFSVT FGQYDSSENI  480
CSLQDLKSKE VESLEMNTMQ DDIAKLLDWG SDSGEISNGQ SSAVTDDNLV LDVHQFASLY  540
PADSTAAAND QHNNNNNNNN NFSWDDLD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C9e-31271292103C-Myb DNA-Binding Domain
1mse_C9e-31271292103C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1435440RPPKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893030.0AC189303.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB030F12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013628926.10.0PREDICTED: myb-like protein A
TrEMBLA0A078J9220.0A0A078J922_BRANA; BnaC03g71630D protein
STRINGBra028997.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99391934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55020.12e-82myb domain protein 120